PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S00560.30
Common NameJCGZ_07620
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family Nin-like
Protein Properties Length: 507aa    MW: 57513 Da    PI: 5.0698
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S00560.30genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK69.74.2e-22241287248
         RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRk 48 
                    + +++l+d ++yF+lpi++AA+ +++c+Tv+K+iCR+ G++RWPhRk
  Jcr4S00560.30 241 TGKLTLKDFEAYFHLPIEEAARRINLCPTVVKKICRRDGMNRWPHRK 287
                    5689******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151914.504231311IPR003035RWP-RK domain
PfamPF020424.6E-19243287IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 507 aa     Download sequence    Send to blast
MADPRSVVPY HDPHDGPIDY DYLSFILDSN PNLVNLSPVN EPNSIDLSSD NNVTAPDHHF  60
EDPTIWNISN ESNNMGVQPQ IEGPSQSQNV TEAENSQRPS CLDGGMSLPV WPPPITPFSC  120
TYCQVLREIV HTDGICTTKL EIHGRLGVIC HAIFQSRNSV QAVSSVPQYH MLDFCKKSID  180
KVKQFLQQYC DDKKQAGYVI LQDPLSVFYE ALCVGIEWDE TLNNDDFFDP SPSFSVQRER  240
TGKLTLKDFE AYFHLPIEEA ARRINLCPTV VKKICRRDGM NRWPHRKQCG GKDACSSRDP  300
KAPRRNIQPL CWRRVKQEAP QEWDENMPLP EDIIEGFAED DDDELFMPAK ANSELSSQLG  360
KKSIIAKKDI QQERSDIYWK MKMDNYLPDR QSSVISSILF FPMQGEYCID ATTARCMAWF  420
SAAVSSGVPL IFVNIQTEQT ITSVPLKHEL KEKAQCTGKE PIWGGQNNHN ASVHIMQGIR  480
LWFLPGIAQV VIEMTLEPGE ERIGNRH
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012077555.10.0PREDICTED: uncharacterized protein LOC105638373
TrEMBLA0A067KQE70.0A0A067KQE7_JATCU; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF74782846
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76350.17e-09Nin-like family protein
Publications ? help Back to Top
  1. Zhang L, et al.
    Global analysis of gene expression profiles in physic nut (Jatropha curcas L.) seedlings exposed to salt stress.
    PLoS ONE, 2014. 9(5): p. e97878
    [PMID:24837971]